PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1873s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 637aa    MW: 72225.2 Da    PI: 7.0164
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1873s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.1e-094084451954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Cagra.1873s0010.1.p 408 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 445
                          554459******************************88 PP

2BELL107.48.8e-35266337172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          e++elqk+kakLls+lee+++rY +y+eq+++ ++sFea++g+g+a++Yt+lA++a+SrhFrcLkd +++qi
  Cagra.1873s0010.1.p 266 EFMELQKRKAKLLSMLEELKRRYGHYREQMRVAAASFEAAVGVGAAEVYTALASRAMSRHFRCLKDGLVGQI 337
                          679*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075261.0E-42192333IPR006563POX domain
SMARTSM005749.5E-68198335IPR006563POX domain
PROSITE profilePS5007112.017386449IPR001356Homeobox domain
CDDcd000862.30E-10389450No hitNo description
SMARTSM003895.6E-9389453IPR001356Homeobox domain
SuperFamilySSF466893.29E-17390457IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-28392456IPR009057Homeodomain-like
PfamPF059208.5E-18406445IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MARDQFYGHH HNQEQQQQQH QMINQIQGFD ETNQNQTDHH HHYNHQIFGS NSNMGMMIDF  60
SKQQQIRMTT SGPDHQHHHH HHDQTSGGTD QNQLLEDSSS TMRLCNVNND FPSEVNDERP  120
PQRPSQGLSL SLSSSNPSSI SLQSFDLRTQ QGYSGKSSTH HQNLQHSQMM MMMMNSHHQN  180
NNHQHHHHQF QIGSSKYLSP AQELLSEFCS LGVKESDEEV MMMKNKRKQK GKQQEDWDTS  240
HNNNDQQDQS ATTSSKKHVP PLHSLEFMEL QKRKAKLLSM LEELKRRYGH YREQMRVAAA  300
SFEAAVGVGA AEVYTALASR AMSRHFRCLK DGLVGQIQAT SQALGEREED SRAVSIAARG  360
ETPRLRLLDQ ALRQQKSYRQ MTLVDAHPWR PQRGLPERAV TTLRAWLFEH FLHPYPSDVD  420
KHILARQTGL SRSQVSNWFI NARVRLWKPM IEEMYCEETR GEQVMDITTT TTTTTNPMMM  480
MMIDTKPDPN QMIRIEPESL SSIVTNPTSK MTGQTKATTT TFGSTFDFSL YGNNQAVTYA  540
GEGGGPRGDV SLTLGLQQRN DGNGGVSLAL SPLTTAHQGT TTTTTGQLYY GTSNIRDHID  600
QEGPVHQYSA SMLDDDQVQN LPYRNLMGAQ LLHDLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15395453563Homeobox protein Meis2
3k2a_B2e-15395453563Homeobox protein Meis2
4xrm_A2e-15395453563Homeobox protein Meis2
4xrm_B2e-15395453563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU399440.0U39944.2 Arabidopsis thaliana homeobox protein (BEL1) mRNA, complete cds.
GenBankAY0492370.0AY049237.1 Arabidopsis thaliana AT5g41410/MYC6_12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283321.10.0hypothetical protein CARUB_v10004359mg
SwissprotQ388970.0BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLR0GHD60.0R0GHD6_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__3270__AT5G41410.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58662639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.10.0TALE family protein